0item(s)

You have no items in your shopping cart.

Product was successfully added to your shopping cart.
  • LL-37 - 5mg LL-37 - 5mg

LL-37 - 5mg

Availability: In stock

Regular Price: $99.95

Special Price $59.95

  • Buy 10 for $54.95 each and save 9%
  • Buy 20 for $49.95 each and save 17%
  • Buy 50 for $39.95 each and save 34%
  • Buy 100 for $29.95 each and save 51%

Details

Note: Our peptide products are not intended to treat, prevent, mitigate or cure any disease or medical condition. Researchers must be at least eighteen (18) years of age to buy TA-1.

Additional Information

Product Video No
Is Featured Yes
Image Gallery N/A
Full Name LL-37
Purity 98%
Appearance White Powder
Solubility Soluble in water or %1 acetic acid
Storage Stable at 2-8*C
Molecular Formula C205H340N60O53
Molecular Weight 4493.28
Sequence [LL-37, 37 aa]